Sequence: MIVKYIKGDIVALFAEGKNIAHGCNCFHTMGSGVAGQLTKAFPKILEADKLQTEWGDVTKLGSYSVYEKYFRTHKAYCFNLYTQFQPGPNFEYSALMNCMLELNEFGENKLIKPTIYMPRIGAGIGKGNWDIIEGILDTYSSKLEIVIVDWEPLL
| Product: | phosphatase |
|---|---|
| Virus name: | Bacteriophage T4 |
| Natural Host: | Escherichia coli |
| Lab host: | None |
| ID: | cds-NP_049723.1 |
| Source: | RefSeq |
| Sequence Region: | NC_000866.4 |
| CDS Start: | 60922 |
| CDS End: | 61389 |
| Dbxref: | GenBank:NP_049723.1,GeneID:1258663 |
| Note: | Tk.4%3B contains A1pp phosphatase motif |
| Protein ID: | NP_049723.1 |
| Sequence length: | 155 |
| Dbxref Host: | taxon:2681598 |
| 3D structure: | Structure is not available, could be due to sequence length (limit is 400) |