Sequence: MIVKYIKGDIVALFAEGKNIAHGCNCFHTMGSGVAGQLTKAFPKILEADKLQTEWGDVTKLGSYSVYEKYFRTHKAYCFNLYTQFQPGPNFEYSALMNCMLELNEFGENKLIKPTIYMPRIGAGIGKGNWDIIEGILDTYSSKLEIVIVDWEPLL
Product: | phosphatase |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049723.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 60922 |
CDS End: | 61389 |
Dbxref: | GenBank:NP_049723.1,GeneID:1258663 |
Note: | Tk.4%3B contains A1pp phosphatase motif |
Protein ID: | NP_049723.1 |
Sequence length: | 155 |
Dbxref Host: | taxon:2681598 |
3D structure: | Structure is not available, could be due to sequence length (limit is 400) |