Sequence: MTKILVLCIGLISFSASASADTSYTEIREYVNRTAADYCGKNKACQAEFAQKLIYAYKDGERDKSSRYKNDTLLKRYAKKWNTLECSVAEEKDKAACHSMVDRLVDSYNRGLSTR
Product: | valyl tRNA synthetase modifier |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049724.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 61386 |
CDS End: | 61733 |
Dbxref: | GenBank:NP_049724.1,GeneID:1258658 |
Note: | None |
Protein ID: | NP_049724.1 |
Sequence length: | 115 |
Dbxref Host: | taxon:2681598 |
3D structure: | Structure is not available, could be due to sequence length (limit is 400) |