Sequence: MMTDTQLFEYLYFSPKTIKNKLVNHFEILAKNNILSEFYPKQYKLQKGVFKGCRVLCTAPNARLMNKIPYFTMEFIDGPFKGLITQSLMAYDSEPFLIKEQSWINLFSN
Product: | hypothetical protein |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049731.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 63927 |
CDS End: | 64256 |
Dbxref: | GenBank:NP_049731.1,GeneID:1258716 |
Note: | None |
Protein ID: | NP_049731.1 |
Sequence length: | 109 |
Dbxref Host: | taxon:2681598 |
3D structure: |
Stucture predicted by ESMFold v1 plDDTplDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100. plDDT: 0.3277 |