Sequence Detail

Sequence: MRDSRQPVIRSSPSAVMGKYRNGQFMCHGMAQTYRAYREEMRTFLTGPYLSLMNAFTHHSDARVEEICKNEYIPPFEDLLKQYCTLRLDGGRQSGKSIAVTNFAANWLYDGGTVIVLSNTSAYAKISANNIKKEFSRYSNDDIRFRLFTDSVRSFIGNKGSKFRGLKLSRILYIIDEPVKSPDMDKIYSVHIDTVHYCCNSKCCIGGITRPQFFVIGMQ

Associated Protein Details

Product: hypothetical protein
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049732.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 64253
CDS End: 64912
Dbxref: GenBank:NP_049732.1,GeneID:1258713
Note: None
Protein ID: NP_049732.1
Sequence length: 219
Dbxref Host: taxon:2681598
3D structure:

Stucture predicted by ESMFold v1

plDDT

plDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100.

plDDT: 0.5875

Download PDB File