Sequence: MKTYQEFIAEARVGAGKLEAAVNKKAHSFHDLPDKDRKKLVSLYIDRERILALPGANEGKQAKPLNAVEKKIDNFASKFGMSMDDLQQAAIEAAKAIKDK
| Product: | internal virion protein |
|---|---|
| Virus name: | Bacteriophage T4 |
| Natural Host: | Escherichia coli |
| Lab host: | None |
| ID: | cds-NP_049734.1 |
| Source: | RefSeq |
| Sequence Region: | NC_000866.4 |
| CDS Start: | 65416 |
| CDS End: | 65718 |
| Dbxref: | GenBank:NP_049734.1,GeneID:1258729 |
| Note: | None |
| Protein ID: | NP_049734.1 |
| Sequence length: | 100 |
| Dbxref Host: | taxon:2681598 |
| 3D structure: | Structure is not available, could be due to sequence length (limit is 400) |