Sequence: MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPCLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL
Product: | deoxynucleoside monophosphate kinase |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049752.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 74649 |
CDS End: | 75374 |
Dbxref: | GenBank:NP_049752.1,GeneID:1258557 |
Note: | gp1%3B catalyses the phosphorylation of canonical nucleotides to the corresponding diphosphates using ATP as a phosphate donor%3B recognizes three structurally dissimilar nucleotides: dGMP%2C dTMP and 5-hydroxymethyl-dCMP while excluding dCMP and dAMP |
Protein ID: | NP_049752.1 |
Sequence length: | 241 |
Dbxref Host: | taxon:2681598 |
3D structure: | Structure is not available, could be due to sequence length (limit is 400) |