Sequence: MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPCLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL
| Product: | deoxynucleoside monophosphate kinase |
|---|---|
| Virus name: | Bacteriophage T4 |
| Natural Host: | Escherichia coli |
| Lab host: | None |
| ID: | cds-NP_049752.1 |
| Source: | RefSeq |
| Sequence Region: | NC_000866.4 |
| CDS Start: | 74649 |
| CDS End: | 75374 |
| Dbxref: | GenBank:NP_049752.1,GeneID:1258557 |
| Note: | gp1%3B catalyses the phosphorylation of canonical nucleotides to the corresponding diphosphates using ATP as a phosphate donor%3B recognizes three structurally dissimilar nucleotides: dGMP%2C dTMP and 5-hydroxymethyl-dCMP while excluding dCMP and dAMP |
| Protein ID: | NP_049752.1 |
| Sequence length: | 241 |
| Dbxref Host: | taxon:2681598 |
| 3D structure: | Structure is not available, could be due to sequence length (limit is 400) |