Sequence Detail

Sequence: MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPCLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL

Associated Protein Details

Product: deoxynucleoside monophosphate kinase
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049752.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 74649
CDS End: 75374
Dbxref: GenBank:NP_049752.1,GeneID:1258557
Note: gp1%3B catalyses the phosphorylation of canonical nucleotides to the corresponding diphosphates using ATP as a phosphate donor%3B recognizes three structurally dissimilar nucleotides: dGMP%2C dTMP and 5-hydroxymethyl-dCMP while excluding dCMP and dAMP
Protein ID: NP_049752.1
Sequence length: 241
Dbxref Host: taxon:2681598
3D structure:

Stucture predicted by ESMFold v1

plDDT

plDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100.

plDDT: 0.8961

Download PDB File