Sequence: MAYSGKWVPKNISKYRGDPKKITYRSNWEKFFFEWLDKNPEIIAWGSETAVIPYFCNAEGKKRRYFMDIWMKDSSGQEFFIEIKPKKETQPPVKPAHLTTAAKKRFMNEIYTWSVNTDKWKAAQSLAEKRGIKFRILTEDGLRALGFKGA
| Product: | head closure |
|---|---|
| Virus name: | Bacteriophage T4 |
| Natural Host: | Escherichia coli |
| Lab host: | None |
| ID: | cds-NP_049755.1 |
| Source: | RefSeq |
| Sequence Region: | NC_000866.4 |
| CDS Start: | 76885 |
| CDS End: | 77337 |
| Dbxref: | GenBank:NP_049755.1,GeneID:1258590 |
| Note: | gp4%3B gp50%3B gp65%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B the virion head goes through several maturation steps including the construction of the prohead%2C enzymatic processing of the prohead%2C and DNA packaging%3B gp4 is thought to participate in the final steps of head maturation%2C prior to the attachment of the virion tail |
| Protein ID: | NP_049755.1 |
| Sequence length: | 150 |
| Dbxref Host: | taxon:2681598 |
| 3D structure: |
Stucture predicted by ESMFold v1 plDDTplDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100. plDDT: 0.8133 |