Sequence Detail

Sequence: MAYSGKWVPKNISKYRGDPKKITYRSNWEKFFFEWLDKNPEIIAWGSETAVIPYFCNAEGKKRRYFMDIWMKDSSGQEFFIEIKPKKETQPPVKPAHLTTAAKKRFMNEIYTWSVNTDKWKAAQSLAEKRGIKFRILTEDGLRALGFKGA

Associated Protein Details

Product: head closure
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049755.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 76885
CDS End: 77337
Dbxref: GenBank:NP_049755.1,GeneID:1258590
Note: gp4%3B gp50%3B gp65%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B the virion head goes through several maturation steps including the construction of the prohead%2C enzymatic processing of the prohead%2C and DNA packaging%3B gp4 is thought to participate in the final steps of head maturation%2C prior to the attachment of the virion tail
Protein ID: NP_049755.1
Sequence length: 150
Dbxref Host: taxon:2681598
3D structure: Structure is not available, could be due to sequence length (limit is 400)