Sequence Detail

Sequence: MLFTFFDPIEYAAKTVNKNAPTIPMTDIFRNYKDYFKRALAGYRLRTYYIKGSPRPEELANAIYGNPQLYWVLLMCNDNYDPYYGWITSQEAAYQASIQKYKNVGGDQIVYHVNENGEKFYNLISYDDNPYVWYDKGDKARKYPQYEGALAAVDTYEAAVLENEKLRQIKIIAKSDINSFMNDLIRIMEKSYGNDK

Associated Protein Details

Product: baseplate wedge subunit
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049756.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 77385
CDS End: 77975
Dbxref: GenBank:NP_049756.1,GeneID:1258693
Note: gp53%3B structural virion protein%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B the capsid contractile tail consists of a contractile outer sheath%2C a inner tube%2C and a baseplate%3B gp53 is a component of the baseplate
Protein ID: NP_049756.1
Sequence length: 196
Dbxref Host: taxon:2681598
3D structure: Structure is not available, could be due to sequence length (limit is 400)