Sequence: MLFTFFDPIEYAAKTVNKNAPTIPMTDIFRNYKDYFKRALAGYRLRTYYIKGSPRPEELANAIYGNPQLYWVLLMCNDNYDPYYGWITSQEAAYQASIQKYKNVGGDQIVYHVNENGEKFYNLISYDDNPYVWYDKGDKARKYPQYEGALAAVDTYEAAVLENEKLRQIKIIAKSDINSFMNDLIRIMEKSYGNDK
Product: | baseplate wedge subunit |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049756.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 77385 |
CDS End: | 77975 |
Dbxref: | GenBank:NP_049756.1,GeneID:1258693 |
Note: | gp53%3B structural virion protein%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B the capsid contractile tail consists of a contractile outer sheath%2C a inner tube%2C and a baseplate%3B gp53 is a component of the baseplate |
Protein ID: | NP_049756.1 |
Sequence length: | 196 |
Dbxref Host: | taxon:2681598 |
3D structure: | Structure is not available, could be due to sequence length (limit is 400) |