Sequence: MLFTFFDPIEYAAKTVNKNAPTIPMTDIFRNYKDYFKRALAGYRLRTYYIKGSPRPEELANAIYGNPQLYWVLLMCNDNYDPYYGWITSQEAAYQASIQKYKNVGGDQIVYHVNENGEKFYNLISYDDNPYVWYDKGDKARKYPQYEGALAAVDTYEAAVLENEKLRQIKIIAKSDINSFMNDLIRIMEKSYGNDK
| Product: | baseplate wedge subunit |
|---|---|
| Virus name: | Bacteriophage T4 |
| Natural Host: | Escherichia coli |
| Lab host: | None |
| ID: | cds-NP_049756.1 |
| Source: | RefSeq |
| Sequence Region: | NC_000866.4 |
| CDS Start: | 77385 |
| CDS End: | 77975 |
| Dbxref: | GenBank:NP_049756.1,GeneID:1258693 |
| Note: | gp53%3B structural virion protein%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B the capsid contractile tail consists of a contractile outer sheath%2C a inner tube%2C and a baseplate%3B gp53 is a component of the baseplate |
| Protein ID: | NP_049756.1 |
| Sequence length: | 196 |
| Dbxref Host: | taxon:2681598 |
| 3D structure: |
Stucture predicted by ESMFold v1 plDDTplDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100. plDDT: 0.6788 |