Sequence Detail

Sequence: MVIFQLEYPLHHLVLFEVDADQPHEHEHDLILMGPFYLQQHRQTN

Associated Protein Details

Product: replication initiation protein
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049758.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 77981
CDS End: 78118
Dbxref: GenBank:NP_049758.1,GeneID:1258816
Note: None
Protein ID: NP_049758.1
Sequence length: 45
Dbxref Host: taxon:2681598
3D structure:

Stucture predicted by ESMFold v1

plDDT

plDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100.

plDDT: 0.427

Download PDB File