Sequence: MVIFQLEYPLHHLVLFEVDADQPHEHEHDLILMGPFYLQQHRQTN
Product: | replication initiation protein |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049758.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 77981 |
CDS End: | 78118 |
Dbxref: | GenBank:NP_049758.1,GeneID:1258816 |
Note: | None |
Protein ID: | NP_049758.1 |
Sequence length: | 45 |
Dbxref Host: | taxon:2681598 |
3D structure: |
Stucture predicted by ESMFold v1 plDDTplDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100. plDDT: 0.427 |