Sequence: MEGSSIDVTFTAQLETGETLVSINITSYEETPGVLVEENRLYGTYESVFGFGNDALKYRLGDEFKTAASWEELPTDSDTQLYLWKAPQNLQKTFTYEVTLIYDYQEQSESGGSGSNSRSSSDTTEPTDPPAPVRKTLVKNYTKTIVGNWSRWANKLRKYAYARP
Product: | hypothetical protein |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049760.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 79721 |
CDS End: | 80215 |
Dbxref: | GenBank:NP_049760.1,GeneID:1258586 |
Note: | None |
Protein ID: | NP_049760.1 |
Sequence length: | 164 |
Dbxref Host: | taxon:2681598 |
3D structure: | Structure is not available, could be due to sequence length (limit is 400) |