Sequence: MSLLNNKAGVISRLADFLGFRPKTGDIDVMNRQSVGSVTISQLAKGFYEPNIESAINDVHNFSIKDVGTIITNKTGVSPEGVSQTDYWAFSGTVTDDSLPPGSPITVLVFGLPVSATTGMTAIEFVAKVRVALQEAIASFTAINSYKDHPTDGSKLEVTYLDNQKHVLSTYSTYGITISQEIISESKPGYGTWNLLGAQTVTLDNQQTPTVFYHFERTA
Product: | baseplate wedge subunit |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049769.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 89893 |
CDS End: | 90552 |
Dbxref: | GenBank:NP_049769.1,GeneID:1258638 |
Note: | gp11%3B structural virion protein%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B the capsid tail consists of a contractile outer sheath%2C a inner tube%2C and a baseplate%3B the baseplate consists of a hub surrounded by six wedges%3B gp11 is a component of the wedges and binds the short tail fiber |
Protein ID: | NP_049769.1 |
Sequence length: | 219 |
Dbxref Host: | taxon:2681598 |
3D structure: |
Stucture predicted by ESMFold v1 plDDTplDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100. plDDT: 0.6228 |