Sequence Detail

Sequence: MSLLNNKAGVISRLADFLGFRPKTGDIDVMNRQSVGSVTISQLAKGFYEPNIESAINDVHNFSIKDVGTIITNKTGVSPEGVSQTDYWAFSGTVTDDSLPPGSPITVLVFGLPVSATTGMTAIEFVAKVRVALQEAIASFTAINSYKDHPTDGSKLEVTYLDNQKHVLSTYSTYGITISQEIISESKPGYGTWNLLGAQTVTLDNQQTPTVFYHFERTA

Associated Protein Details

Product: baseplate wedge subunit
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049769.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 89893
CDS End: 90552
Dbxref: GenBank:NP_049769.1,GeneID:1258638
Note: gp11%3B structural virion protein%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B the capsid tail consists of a contractile outer sheath%2C a inner tube%2C and a baseplate%3B the baseplate consists of a hub surrounded by six wedges%3B gp11 is a component of the wedges and binds the short tail fiber
Protein ID: NP_049769.1
Sequence length: 219
Dbxref Host: taxon:2681598
3D structure:

Stucture predicted by ESMFold v1

plDDT

plDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100.

plDDT: 0.6228

Download PDB File