Sequence: MATYDKNLFAKLENRTGYSQTNETEILNPYVNFNHYKNSQILADVLVAESIQMRGVECYYVPREYVSPDLIFGEDLKNKFTKAWKFAAYLNSFEGYEGAKSFFSNFGMQVQDEVTLSINPNLFKHQVNGKEPKEGDLIYFPMDNSLFEINWVEPYDPFYQLGQNAIRKITAGKFIYSGEEINPVLQKNEGINIPEFSELELNAVRNLNGIHDINIDQYAEVDQINSEAKEYVEPYVVVNNRGKSFESSPFDNDFMD
| Product: | head closure Hc2 |
|---|---|
| Virus name: | Bacteriophage T4 |
| Natural Host: | Escherichia coli |
| Lab host: | None |
| ID: | cds-NP_049773.1 |
| Source: | RefSeq |
| Sequence Region: | NC_000866.4 |
| CDS Start: | 94555 |
| CDS End: | 95325 |
| Dbxref: | GenBank:NP_049773.1,GeneID:1258695 |
| Note: | gp14%3B structural virion protein%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B the capsid tail consists of a contractile outer sheath%2C a inner tube%2C and a baseplate%3B after DNA is packaged into the head%2C gp13%2C gp14%2C and six trimers of gp wac (whisker or fibritin) bind to the portal vertex to complete the head%2C which then binds to the tail |
| Protein ID: | NP_049773.1 |
| Sequence length: | 256 |
| Dbxref Host: | taxon:2681598 |
| 3D structure: | Structure is not available, could be due to sequence length (limit is 400) |