Sequence Detail

Sequence: MFVDDVTRAFESGDFARPNLFQVEISYLGQNFTFQCKATALPAGIVEKIPVGFMNRKINVAGDRTFDDWTVTVMNDEAHDARQKFVDWQSIAAGQGNEITGGKPAEYKKSAIVRQYARDAKTVTKEIEIKGLWPTNVGELQLDWDSNNEIQTFEVTLALDYWE

Associated Protein Details

Product: tail protein
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049781.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 100632
CDS End: 101123
Dbxref: GenBank:NP_049781.1,GeneID:1258727
Note: gp19%3B structural virion protein%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B the capsid tail consists of a contractile outer sheath%2C a inner tube%2C and a baseplate%3B the tube allows passage of DNA%3B gp19 forms the inner tube%3B 144 gp19 protomers are arranged in 24 stacked hexameric rings%3B each ring is offset to produce an apparent right handed helix
Protein ID: NP_049781.1
Sequence length: 163
Dbxref Host: taxon:2681598
3D structure: Structure is not available, could be due to sequence length (limit is 400)