Sequence Detail

Sequence: MEGLIEAIKSNDLVAARKLFAEAMAARTIDLIKEEKIAIARNFLIEGEEPEDEDEDEDDEDSDDKDDKKDEDSDEDEDDE

Associated Protein Details

Product: prohead
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049783.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 102781
CDS End: 103023
Dbxref: GenBank:NP_049783.1,GeneID:1258665
Note: gp67%3B pip%3B virion protein%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B the virion head goes through several maturation steps including the construction of the prohead%2C enzymatic processing of the prohead%2C and DNA packaging%3B gp67 is a scaffolding protein around which shell proteins are assembled during the construction of the prohead
Protein ID: NP_049783.1
Sequence length: 80
Dbxref Host: taxon:2681598
3D structure:

Stucture predicted by ESMFold v1

plDDT

plDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100.

plDDT: 0.6161

Download PDB File