Sequence: MEGLIEAIKSNDLVAARKLFAEAMAARTIDLIKEEKIAIARNFLIEGEEPEDEDEDEDDEDSDDKDDKKDEDSDEDEDDE
Product: | prohead |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049783.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 102781 |
CDS End: | 103023 |
Dbxref: | GenBank:NP_049783.1,GeneID:1258665 |
Note: | gp67%3B pip%3B virion protein%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B the virion head goes through several maturation steps including the construction of the prohead%2C enzymatic processing of the prohead%2C and DNA packaging%3B gp67 is a scaffolding protein around which shell proteins are assembled during the construction of the prohead |
Protein ID: | NP_049783.1 |
Sequence length: | 80 |
Dbxref Host: | taxon:2681598 |
3D structure: |
Stucture predicted by ESMFold v1 plDDTplDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100. plDDT: 0.6161 |