Sequence: MNEPQLLIETWGQPGEIIDGVPMLESHDGKDLGLKPGLYIEGIFMQAEVVNRNKRLYPKRILEKAVKDYINEQVLTKQALGELNHPPRANVDPMQAAIIIEDMWWKGNDVYGRARVIEGDHGPGDKLAANIRAGWIPGVSSRGLGSLTDTNEGYRIVNEGFKLTVGVDAVWGPSAPDAWVTPKEITESQTAEADTSADDAYMALAEAMKKAL
| Product: | head maturation protease |
|---|---|
| Virus name: | Bacteriophage T4 |
| Natural Host: | Escherichia coli |
| Lab host: | None |
| ID: | cds-NP_049785.1 |
| Source: | RefSeq |
| Sequence Region: | NC_000866.4 |
| CDS Start: | 103448 |
| CDS End: | 104086 |
| Dbxref: | GenBank:NP_049785.1,GeneID:1258771 |
| Note: | gp21%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B capsid head is assembled on an initiator complex of gp20%3B the gp22-gp21 scaffold and the gp23 capsid protein are assembled onto the initiator%3B after the scaffold is completely surrounded by gp23 and gp24%2C the T4 prohead protease%2C gp21%2C degrades the scaffold and cleaves most of the other head proteins%2C including gp23 and gp24%2C creating space in the cavity of the prohead |
| Protein ID: | NP_049785.1 |
| Sequence length: | 212 |
| Dbxref Host: | taxon:2681598 |
| 3D structure: | Structure is not available, could be due to sequence length (limit is 400) |