Sequence Detail

Sequence: MLESHDGKDLGLKPGLYIEGIFMQAEVVNRNKRLYPKRILEKAVKDYINEQVLTKQALGELNHPPRANVDPMQAAIIIEDMWWKGNDVYGRARVIEGDHGPGDKLAANIRAGWIPGVSSRGLGSLTDTNEGYRIVNEGFKLTVGVDAVWGPSAPDAWVTPKEITESQTAEADTSADDAYMALAEAMKKAL

Associated Protein Details

Product: head maturation protease
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_813810.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 103514
CDS End: 104086
Dbxref: GenBank:NP_813810.1,GeneID:1258621
Note: gp21%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B capsid head is assembled on an initiator complex of gp20%3B the gp22-gp21 scaffold and the gp23 capsid protein are assembled onto the initiator%3B after the scaffold is completely surrounded by gp23 and gp24%2C the T4 prohead protease%2C gp21%2C degrades the scaffold and cleaves most of the other head proteins%2C including gp23 and gp24%2C creating space in the cavity of the prohead
Protein ID: NP_813810.1
Sequence length: 190
Dbxref Host: taxon:2681598
3D structure: Structure is not available, could be due to sequence length (limit is 400)