Sequence: MLESHDGKDLGLKPGLYIEGIFMQAEVVNRNKRLYPKRILEKAVKDYINEQVLTKQALGELNHPPRANVDPMQAAIIIEDMWWKGNDVYGRARVIEGDHGPGDKLAANIRAGWIPGVSSRGLGSLTDTNEGYRIVNEGFKLTVGVDAVWGPSAPDAWVTPKEITESQTAEADTSADDAYMALAEAMKKAL
Product: | head maturation protease |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_813810.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 103514 |
CDS End: | 104086 |
Dbxref: | GenBank:NP_813810.1,GeneID:1258621 |
Note: | gp21%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B capsid head is assembled on an initiator complex of gp20%3B the gp22-gp21 scaffold and the gp23 capsid protein are assembled onto the initiator%3B after the scaffold is completely surrounded by gp23 and gp24%2C the T4 prohead protease%2C gp21%2C degrades the scaffold and cleaves most of the other head proteins%2C including gp23 and gp24%2C creating space in the cavity of the prohead |
Protein ID: | NP_813810.1 |
Sequence length: | 190 |
Dbxref Host: | taxon:2681598 |
3D structure: | Structure is not available, could be due to sequence length (limit is 400) |