Sequence: MLESHDGKDLGLKPGLYIEGIFMQAEVVNRNKRLYPKRILEKAVKDYINEQVLTKQALGELNHPPRANVDPMQAAIIIEDMWWKGNDVYGRARVIEGDHGPGDKLAANIRAGWIPGVSSRGLGSLTDTNEGYRIVNEGFKLTVGVDAVWGPSAPDAWVTPKEITESQTAEADTSADDAYMALAEAMKKAL
| Product: | head maturation protease |
|---|---|
| Virus name: | Bacteriophage T4 |
| Natural Host: | Escherichia coli |
| Lab host: | None |
| ID: | cds-NP_813810.1 |
| Source: | RefSeq |
| Sequence Region: | NC_000866.4 |
| CDS Start: | 103514 |
| CDS End: | 104086 |
| Dbxref: | GenBank:NP_813810.1,GeneID:1258621 |
| Note: | gp21%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B capsid head is assembled on an initiator complex of gp20%3B the gp22-gp21 scaffold and the gp23 capsid protein are assembled onto the initiator%3B after the scaffold is completely surrounded by gp23 and gp24%2C the T4 prohead protease%2C gp21%2C degrades the scaffold and cleaves most of the other head proteins%2C including gp23 and gp24%2C creating space in the cavity of the prohead |
| Protein ID: | NP_813810.1 |
| Sequence length: | 190 |
| Dbxref Host: | taxon:2681598 |
| 3D structure: |
Stucture predicted by ESMFold v1 plDDTplDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100. plDDT: 0.8956 |