Sequence Detail

Sequence: MANIIRCKLPDGVHRFKPFTVEDYRDFLLVRNDIEHRSPQEQKQIITDLIDDYFGDYPKTWQPFIFLQVFVGSIGKTKSTVTFICPKCKKEKTVPFEIYQKELKDLVFDVANVKIKLKFPSEFYENKAKMITENIHSVQVDEIWYDWKEISESSQIELVDAIEIETLEKILDAMNPINLTLHMSCCNKYIKKYTDIVDVFKLLVNPDEIFTFYQINHTLVKSNYSLNSISKMIPAERGFVLKLIEKDKQ

Associated Protein Details

Product: baseplate hub assembly protein
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049802.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 116479
CDS End: 117228
Dbxref: GenBank:NP_049802.1,GeneID:1258640
Note: gp51%3B chaperone%3B in bacteriophage T4 and related viruses%2C the virion is composed of head and tail components%3B the capsid tail consists of a contractile outer sheath%2C a inner tube%2C and a baseplate%3B the baseplate consists of a hub surrounded by six wedges%3B gp51 catalyzes assembly of the hub
Protein ID: NP_049802.1
Sequence length: 249
Dbxref Host: taxon:2681598
3D structure: Structure is not available, could be due to sequence length (limit is 400)