Sequence: MNLNLILPLKKVVLPISNKEVSIPKMGLKHYNILKDVKGPDENLKLLIDSICPNLSPAEVDFVSIHLLEFNGKIKSRKEIDGYTYDINDVYVCQRLEFQYQGNTFYFRPPGKFEQFLTVSDMLSKCLLRVNDEVKEINFLEMPAFVLKWANDIFTTLAIPGPNGPITGIGNIIGLFE
| Product: | baseplate hub distal subunit |
|---|---|
| Virus name: | Bacteriophage T4 |
| Natural Host: | Escherichia coli |
| Lab host: | None |
| ID: | cds-NP_049804.2 |
| Source: | RefSeq |
| Sequence Region: | NC_000866.4 |
| CDS Start: | 118348 |
| CDS End: | 118881 |
| Dbxref: | GenBank:NP_049804.2,GeneID:1258697 |
| Note: | N-terminal amino acid sequence determined for the gp28 hub subunit by F. Arisaka et al.%2C Department of Molecular and Cellular Assembly%2C Tokyo Institute of Technology%2C Yokohama 226-8501%2C Japan%3B Unpublished observation |
| Protein ID: | NP_049804.2 |
| Sequence length: | 177 |
| Dbxref Host: | taxon:2681598 |
| 3D structure: | Structure is not available, could be due to sequence length (limit is 400) |