Sequence: MNLNLILPLKKVVLPISNKEVSIPKMGLKHYNILKDVKGPDENLKLLIDSICPNLSPAEVDFVSIHLLEFNGKIKSRKEIDGYTYDINDVYVCQRLEFQYQGNTFYFRPPGKFEQFLTVSDMLSKCLLRVNDEVKEINFLEMPAFVLKWANDIFTTLAIPGPNGPITGIGNIIGLFE
Product: | baseplate hub distal subunit |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049804.2 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 118348 |
CDS End: | 118881 |
Dbxref: | GenBank:NP_049804.2,GeneID:1258697 |
Note: | N-terminal amino acid sequence determined for the gp28 hub subunit by F. Arisaka et al.%2C Department of Molecular and Cellular Assembly%2C Tokyo Institute of Technology%2C Yokohama 226-8501%2C Japan%3B Unpublished observation |
Protein ID: | NP_049804.2 |
Sequence length: | 177 |
Dbxref Host: | taxon:2681598 |
3D structure: | Structure is not available, could be due to sequence length (limit is 400) |