Sequence Detail

Sequence: MELITELFDGASAPVVTLNPKHKIPQIFAIQAGEESVLPGFRFCTYTSGGDTNKTLNQAIK

Associated Protein Details

Product: Alt.-1 hypothetical protein
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049810.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 123265
CDS End: 123450
Dbxref: GenBank:NP_049810.1,GeneID:1258764
Note: alt.-1 and alt.-2 together appear to be a duplication of the first part of gene alt%2C into which a stop codon and new start have been inserted%3B function unknown
Protein ID: NP_049810.1
Sequence length: 61
Dbxref Host: taxon:2681598
3D structure:

Stucture predicted by ESMFold v1

plDDT

plDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100.

plDDT: 0.3947

Download PDB File