Sequence: MAHFNECAHLIEGVDKAQNEYWDILGDEKDPLQVMLDMQRFLQIRLANVREYCYHPDKLETAGDVVSWMREQKDCIDDEFRELLTSLGEMSRGEKEASAVWKKWKARYIEAQEKRIDEMSPEDQLEIKFELVDIFHFVLNMFVGLGMNAEEIFKLYYLKNKHNFERQDNGY
Product: | dUTPase |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049646.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 16270 |
CDS End: | 16785 |
Dbxref: | GenBank:NP_049646.1,GeneID:1258544 |
Note: | gp56%3B gp56 is a dCTPase and catalyzes coversion of dCTP to dCMP plus diphosphate%3B gp56 is also a dCDPase/dUTPase%2C dUDPase%3B essential for normal development of all T-even related phages%3B these phages use deoxy-hydroxymethyl-cytosine instead of deoxycytosine in their DNA%3B gp56 hydrolyzes dCTP and dCDP%2C preventing incoorporation into phage DNA |
Protein ID: | NP_049646.1 |
Sequence length: | 171 |
Dbxref Host: | taxon:2681598 |
3D structure: | Structure is not available, could be due to sequence length (limit is 400) |