Sequence: MAHFNECAHLIEGVDKAQNEYWDILGDEKDPLQVMLDMQRFLQIRLANVREYCYHPDKLETAGDVVSWMREQKDCIDDEFRELLTSLGEMSRGEKEASAVWKKWKARYIEAQEKRIDEMSPEDQLEIKFELVDIFHFVLNMFVGLGMNAEEIFKLYYLKNKHNFERQDNGY
| Product: | dUTPase |
|---|---|
| Virus name: | Bacteriophage T4 |
| Natural Host: | Escherichia coli |
| Lab host: | None |
| ID: | cds-NP_049646.1 |
| Source: | RefSeq |
| Sequence Region: | NC_000866.4 |
| CDS Start: | 16270 |
| CDS End: | 16785 |
| Dbxref: | GenBank:NP_049646.1,GeneID:1258544 |
| Note: | gp56%3B gp56 is a dCTPase and catalyzes coversion of dCTP to dCMP plus diphosphate%3B gp56 is also a dCDPase/dUTPase%2C dUDPase%3B essential for normal development of all T-even related phages%3B these phages use deoxy-hydroxymethyl-cytosine instead of deoxycytosine in their DNA%3B gp56 hydrolyzes dCTP and dCDP%2C preventing incoorporation into phage DNA |
| Protein ID: | NP_049646.1 |
| Sequence length: | 171 |
| Dbxref Host: | taxon:2681598 |
| 3D structure: |
Stucture predicted by ESMFold v1 plDDTplDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100. plDDT: 0.6702 |