Sequence Detail

Sequence: MSSIPWIDNEFAYRALAHLPKFTQVNNSSTFKLRFRCPVCGDSKTDQNKARGWYYGDNNEGNIHCYNCNYHAPIGIYLKEFEPDLYREYIFEIRKEKGKSRPIEKPKELPKQPEKKIIKSLPSCVRLDKLAEDHPIIKYVKARCIPKDKWKYLWFTTEWPKLVNSIAPGTYKKEISEPRLVIPIYNANGKAESFQGRALKKDAPQKYITIEAYPEATKIYGVERVKDGDVYVLEGPIDSLFIENGIAITGGQLDLEVVPFKDRRVWVLDNEPRHPDTIKRMTKLVDAGERVMFWDKSPWKSKDVNDMIRKEGATPEQIMEYMKNNIAQGLMAKMRLSKYAKI

Associated Protein Details

Product: DNA primase
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049648.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 17935
CDS End: 18963
Dbxref: GenBank:NP_049648.1,GeneID:1258798
Note: gp61%3B requires interaction with gp41 helicase to synthesize RNA primers at unique template sequemces%3B primes lagging-strand DNA synthesis
Protein ID: NP_049648.1
Sequence length: 342
Dbxref Host: taxon:2681598
3D structure:

Stucture predicted by ESMFold v1

plDDT

plDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100.

plDDT: 0.8591

Download PDB File