Sequence Detail

Sequence: MKFVKIDSSSVDMKKYKLQNNVRRSIKSSSMNYANVAIMTDADHDGLGSIYPSLLGFFSNWPELFEQGRIRFVKTPVIIAQVGKKQEWFYTVAEYESAKDALPKHSIRYIKGLGSLEKSEYREMIQNPVYDVVKLPENWKELFEMLMGDNADLRKEWMSQ

Associated Protein Details

Product: DNA topoisomerase II
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049618.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 2458
CDS End: 2802
Dbxref: GenBank:NP_049618.1,GeneID:1258779
Note: a 50-bp segment is inserted in T4 gene 60 that forms an mRNA secondary structure that is translationally bypassed
Protein ID: NP_049618.1
Sequence length: 160
Dbxref Host: taxon:2681598
3D structure: Structure is not available, could be due to sequence length (limit is 400)