Sequence Detail

Sequence: MKRHKEKKYNYTYVITNLVNNKIYYGTHSTDDLNDGYMGSGTLLAQAKKKYGKKNFNLSILGFYKDFKSARDAERELVTIDVVNDPMTYNLKIGGEGGRRIGYRVSSETKEKISKAQKGKPKHLGFSDVCRKAQLGKKQSEETKAKRKEALLNNPYGYNRNKPSHKRDPIMWDNIEKIKEIWENSGKSGAIKLKKLAIEAGFPNKSYARMLEVFRGTRTLL

Associated Protein Details

Product: homing endonuclease
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049657.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 23570
CDS End: 24235
Dbxref: GenBank:NP_049657.1,GeneID:1258777
Note: GIY-YIG family
Protein ID: NP_049657.1
Sequence length: 221
Dbxref Host: taxon:2681598
3D structure: Structure is not available, could be due to sequence length (limit is 400)