Sequence: MIEITLKKPEDFLKVKETLTRMGIANNKDKVLYQSCHILQKKGLYYIVHFKEMLRMDGRQVEMTEEDEVRRDSIAWLLEDWGLIEIVPGQRTFMKDLTNNFRVISFKQKHEWKLVPKYTIGN
| Product: | translation repressor |
|---|---|
| Virus name: | Bacteriophage T4 |
| Natural Host: | Escherichia coli |
| Lab host: | None |
| ID: | cds-NP_049663.1 |
| Source: | RefSeq |
| Sequence Region: | NC_000866.4 |
| CDS Start: | 29972 |
| CDS End: | 30340 |
| Dbxref: | GenBank:NP_049663.1,GeneID:1258694 |
| Note: | RegA%3B binds mRNA and represses translation |
| Protein ID: | NP_049663.1 |
| Sequence length: | 122 |
| Dbxref Host: | taxon:2681598 |
| 3D structure: | Structure is not available, could be due to sequence length (limit is 400) |