Sequence: MSLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKTKCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAAVPRGKRYGKWAKLVEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKLPLVLKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW
Product: | clamp loader of DNA polymerase |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049664.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 30342 |
CDS End: | 30905 |
Dbxref: | GenBank:NP_049664.1,GeneID:1258559 |
Note: | gp62%3B clamp loader is formed by heterodimer of gp44 and gp62%3B clamp loader forms a complex with gp45 (clamp) in the presence of ATP and loads clamp on DNA%3B clamp loader is necessary for T4 DNA synthesis and late transcription |
Protein ID: | NP_049664.1 |
Sequence length: | 187 |
Dbxref Host: | taxon:2681598 |
3D structure: | Structure is not available, could be due to sequence length (limit is 400) |