Sequence: MSLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKTKCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAAVPRGKRYGKWAKLVEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKLPLVLKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW
| Product: | clamp loader of DNA polymerase |
|---|---|
| Virus name: | Bacteriophage T4 |
| Natural Host: | Escherichia coli |
| Lab host: | None |
| ID: | cds-NP_049664.1 |
| Source: | RefSeq |
| Sequence Region: | NC_000866.4 |
| CDS Start: | 30342 |
| CDS End: | 30905 |
| Dbxref: | GenBank:NP_049664.1,GeneID:1258559 |
| Note: | gp62%3B clamp loader is formed by heterodimer of gp44 and gp62%3B clamp loader forms a complex with gp45 (clamp) in the presence of ATP and loads clamp on DNA%3B clamp loader is necessary for T4 DNA synthesis and late transcription |
| Protein ID: | NP_049664.1 |
| Sequence length: | 187 |
| Dbxref Host: | taxon:2681598 |
| 3D structure: |
Stucture predicted by ESMFold v1 plDDTplDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100. plDDT: 0.4093 |