Sequence Detail

Sequence: MSLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKTKCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAAVPRGKRYGKWAKLVEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKLPLVLKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW

Associated Protein Details

Product: clamp loader of DNA polymerase
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049664.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 30342
CDS End: 30905
Dbxref: GenBank:NP_049664.1,GeneID:1258559
Note: gp62%3B clamp loader is formed by heterodimer of gp44 and gp62%3B clamp loader forms a complex with gp45 (clamp) in the presence of ATP and loads clamp on DNA%3B clamp loader is necessary for T4 DNA synthesis and late transcription
Protein ID: NP_049664.1
Sequence length: 187
Dbxref Host: taxon:2681598
3D structure: Structure is not available, could be due to sequence length (limit is 400)