Sequence Detail

Sequence: MTFDEFKNVMMSQHFKCEVKDDIGHKEIIEYWFEPLEVEDNCIKKVTVCTDWAVSFNFNILDNDTPKSLRDMAVSCIKDAYCEVFDI

Associated Protein Details

Product: gp46.2 hypothetical protein
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049671.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 35168
CDS End: 35431
Dbxref: GenBank:NP_049671.1,GeneID:1258612
Note: None
Protein ID: NP_049671.1
Sequence length: 87
Dbxref Host: taxon:2681598
3D structure: Structure is not available, could be due to sequence length (limit is 400)