Sequence: MSETKPKYNYVNNKELLQAIIDWKTELANNKDPNKVVRQNDTIGLAIMLIAEGLSKRFNFSGYTQSWKQEMIADGIEASIKGLHNFDETKYKNPHAYITQACFNAFVQRIKKERKEVAKKYSYFVHNVYDSRDDDMVALVDETFIQDIYDKMTHYEESTYRTPGAEKKSVVDDSPSLDFLYEAND
Product: | RNA polymerase sigma factor |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049679.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 39600 |
CDS End: | 40157 |
Dbxref: | GenBank:NP_049679.1,GeneID:1258806 |
Note: | gp55%3B RNA polymerase sigma factor%3B transcription factor%3B necessary for 'late' transcription%3B binds specific promoter sequence%3B interacts with gp55 sliding clamp |
Protein ID: | NP_049679.1 |
Sequence length: | 185 |
Dbxref Host: | taxon:2681598 |
3D structure: | Structure is not available, could be due to sequence length (limit is 400) |