Sequence: MSETKPKYNYVNNKELLQAIIDWKTELANNKDPNKVVRQNDTIGLAIMLIAEGLSKRFNFSGYTQSWKQEMIADGIEASIKGLHNFDETKYKNPHAYITQACFNAFVQRIKKERKEVAKKYSYFVHNVYDSRDDDMVALVDETFIQDIYDKMTHYEESTYRTPGAEKKSVVDDSPSLDFLYEAND
| Product: | RNA polymerase sigma factor |
|---|---|
| Virus name: | Bacteriophage T4 |
| Natural Host: | Escherichia coli |
| Lab host: | None |
| ID: | cds-NP_049679.1 |
| Source: | RefSeq |
| Sequence Region: | NC_000866.4 |
| CDS Start: | 39600 |
| CDS End: | 40157 |
| Dbxref: | GenBank:NP_049679.1,GeneID:1258806 |
| Note: | gp55%3B RNA polymerase sigma factor%3B transcription factor%3B necessary for 'late' transcription%3B binds specific promoter sequence%3B interacts with gp55 sliding clamp |
| Protein ID: | NP_049679.1 |
| Sequence length: | 185 |
| Dbxref Host: | taxon:2681598 |
| 3D structure: |
Stucture predicted by ESMFold v1 plDDTplDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100. plDDT: 0.7538 |