Sequence Detail

Sequence: MSETKPKYNYVNNKELLQAIIDWKTELANNKDPNKVVRQNDTIGLAIMLIAEGLSKRFNFSGYTQSWKQEMIADGIEASIKGLHNFDETKYKNPHAYITQACFNAFVQRIKKERKEVAKKYSYFVHNVYDSRDDDMVALVDETFIQDIYDKMTHYEESTYRTPGAEKKSVVDDSPSLDFLYEAND

Associated Protein Details

Product: RNA polymerase sigma factor
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049679.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 39600
CDS End: 40157
Dbxref: GenBank:NP_049679.1,GeneID:1258806
Note: gp55%3B RNA polymerase sigma factor%3B transcription factor%3B necessary for 'late' transcription%3B binds specific promoter sequence%3B interacts with gp55 sliding clamp
Protein ID: NP_049679.1
Sequence length: 185
Dbxref Host: taxon:2681598
3D structure: Structure is not available, could be due to sequence length (limit is 400)