Sequence Detail

Sequence: MNPESKLSQRIAEERAKFFQNMKHNGIEDEVFLNWFWNNKYAACEGALSLSVAMMYEGWKGAKKFSLRASAFLDNKILT

Associated Protein Details

Product: gp55.3 hypothetical protein
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049682.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 40799
CDS End: 41038
Dbxref: GenBank:NP_049682.1,GeneID:1258805
Note: None
Protein ID: NP_049682.1
Sequence length: 79
Dbxref Host: taxon:2681598
3D structure: Structure is not available, could be due to sequence length (limit is 400)