Sequence Detail

Sequence: MKWKLRKSLKIANSVAFTYMVRFPDKSFYIGFKKFKTIYGKDTNWKEYNSSSKLVKEKLKDYKAKWIILQVFDSYESALKHEEMLIRKYFNNEFILNKSIGGYKFNKYPDSEEHKQKLSNAHKGKILSLKHKDKIREKLIEHYKNNSRSEAHVKNNIGSRTAKKTVSIALKSGNKFRSFKSAAKFLKCSEEQVSNHPNVIDIKITIHPVPEYVKINDNIYKSFVDAAKDLKLHPSRIKDLCLDDNYPNYIVSYKRVEK

Associated Protein Details

Product: I-TevII homing endonuclease
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049691.2
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 44836
CDS End: 45612
Dbxref: GenBank:NP_049691.2,GeneID:1258800
Note: None
Protein ID: NP_049691.2
Sequence length: 258
Dbxref Host: taxon:2681598
3D structure: Structure is not available, could be due to sequence length (limit is 400)