Sequence: MLLTGKLYKEEKQKFYDAQNGKCLICQRELNPDVQANHLDHDHELNGPKAGKVRGLLCNLCNAAEGQMKHKFNRSGLKGQGVDYLEWLENLLTYLKSDYTQNNIHPNFVGDKSKEFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKKQLRKSLK
Product: | endonuclease VII |
---|---|
Virus name: | Bacteriophage T4 |
Natural Host: | Escherichia coli |
Lab host: | None |
ID: | cds-NP_049692.1 |
Source: | RefSeq |
Sequence Region: | NC_000866.4 |
CDS Start: | 46382 |
CDS End: | 46855 |
Dbxref: | GenBank:NP_049692.1,GeneID:1258702 |
Note: | endo VII%3B gp49%3B cleaves Holliday junctions%2C Y-junctions%2C and mismatched base pairs in heteroduplex DNA%3B involved in recombination mediated replication and packaging |
Protein ID: | NP_049692.1 |
Sequence length: | 157 |
Dbxref Host: | taxon:2681598 |
3D structure: | Structure is not available, could be due to sequence length (limit is 400) |