Sequence Detail

Sequence: MRGLLCNLCNAAEGQMKHKFNRSGLKGQGVDYLEWLENLLTYLKSDYTQNNIHPNFVGDKSKEFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKKQLRKSLK

Associated Protein Details

Product: endonuclease VII
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049693.2
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 46382
CDS End: 46699
Dbxref: GenBank:NP_049693.2,GeneID:1258772
Note: endo VII%3B gp49%3B cleaves Holliday junctions%2C Y-junctions%2C and mismatched base pairs in heteroduplex DNA%3B involved in recombination mediated replication and packaging
Protein ID: NP_049693.2
Sequence length: 105
Dbxref Host: taxon:2681598
3D structure: Structure is not available, could be due to sequence length (limit is 400)