Sequence Detail

Sequence: MFKVYGYDSNIHKCVYCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMPQVFAPDGSHIGGFDQLREYFK

Associated Protein Details

Product: NrdC thioredoxin
Virus name: Bacteriophage T4
Natural Host: Escherichia coli
Lab host: None
ID: cds-NP_049698.1
Source: RefSeq
Sequence Region: NC_000866.4
CDS Start: 48128
CDS End: 48391
Dbxref: GenBank:NP_049698.1,GeneID:1258540
Note: None
Protein ID: NP_049698.1
Sequence length: 87
Dbxref Host: taxon:2681598
3D structure:

Stucture predicted by ESMFold v1

plDDT

plDDT is a per-residue estimate of the confidence in prediction on a scale from 0-100.

plDDT: 0.9071

Download PDB File